current.prt
上传用户:yhdzpy8989
上传日期:2007-06-13
资源大小:13604k
文件大小:7k
- Seq-entry ::= set {
- level 1 ,
- class nuc-prot ,
- descr {
- update-date
- std {
- year 2001 ,
- month 8 ,
- day 1 } ,
- pub {
- pub {
- sub {
- authors {
- names
- std {
- {
- name
- name {
- last "Chen" ,
- initials "T." } } } ,
- affil
- str "Chen T., School of Biomedical Sciences, University of
- Ulster, Cromore Road, Coleraine, Northern Ireland, BT52 ISA, UNITED KINGDOM" } ,
- medium other ,
- date
- std {
- year 2001 ,
- month 7 ,
- day 27 } } } } ,
- pub {
- pub {
- gen {
- cit "Unpublished" ,
- authors {
- names
- std {
- {
- name
- name {
- last "Chen" ,
- initials "T." } } ,
- {
- name
- name {
- last "ORourke" ,
- initials "M." } } ,
- {
- name
- name {
- last "Bjourson" ,
- initials "A.J." } } ,
- {
- name
- name {
- last "McClean" ,
- initials "S." } } ,
- {
- name
- name {
- last "Orr" ,
- initials "D.F." } } ,
- {
- name
- name {
- last "Rao" ,
- initials "P." } } ,
- {
- name
- name {
- last "Hirst" ,
- initials "D." } } ,
- {
- name
- name {
- last "Shaw" ,
- initials "C." } } } } ,
- title "Receptor alchemy: the Chinese toad and his kinin" } } } ,
- source {
- org {
- taxname "Bombina maxima" ,
- common "large-webbed bell toad" ,
- db {
- {
- db "taxon" ,
- tag
- id 161274 } } ,
- orgname {
- name
- binomial {
- genus "Bombina" ,
- species "maxima" } ,
- lineage "Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;
- Euteleostomi; Amphibia; Batrachia; Anura; Archeobatrachia; Bombinatoridae;
- Bombina" ,
- gcode 1 ,
- mgcode 2 ,
- div "VRT" } } ,
- subtype {
- {
- subtype tissue-type ,
- name "skin" } ,
- {
- subtype dev-stage ,
- name "adult" } ,
- {
- subtype country ,
- name "China" } } } ,
- create-date
- std {
- year 2001 ,
- month 8 ,
- day 1 } } ,
- seq-set {
- seq {
- id {
- embl {
- name "BMA315488" ,
- accession "AJ315488" ,
- version 1 } ,
- gi 15072747 } ,
- descr {
- title "Bombina maxima mRNA for kininogen-1" ,
- molinfo {
- biomol mRNA } ,
- embl {
- div vrt ,
- creation-date
- std {
- year 2001 ,
- month 8 ,
- day 1 } ,
- update-date
- std {
- year 2001 ,
- month 8 ,
- day 1 } ,
- keywords {
- "kininogen-1" } } } ,
- inst {
- repr raw ,
- mol rna ,
- length 631 ,
- seq-data
- ncbi2na '092EB041922C66A8D2EDEBE789D12F7B042F74BB47D49DEF4E21EEBDEDC
- 2DDF4FB5EE5E893FD4A057A48E0283BD488B820007892F5E1A3F9708D05902851B516ABDD57FD8
- A00F5325215E6A3F9708D05902851B516ABDD57FD8A00F5325215E6A3F9708D05902851B516ABD
- D57FD8A00F53252D5E6A3F9708D05902851B51AABDD57FD8A00F53252D53B380D092F401E44686
- 5458DE575AB810ED53FABE8'H } } ,
- seq {
- id {
- embl {
- accession "CAC48026" ,
- version 1 } ,
- gi 15072748 } ,
- descr {
- molinfo {
- biomol peptide } } ,
- inst {
- repr raw ,
- mol aa ,
- length 152 ,
- seq-data
- ncbieaa "MRLWFCLSLFIVLCLEHFPGTLADERNVPESEEKTEQFLTDLPKINRKGPRPPGFSPFR
- GKFHSQTLRDLPKINRKGPRPPGFSPFRGKFHSQTLRDLPKINRKGPRPPGFSPFRGKFHSQSLRDLPKINRKGPRPR
- GFSPFRGKFHSQSHV" } ,
- annot {
- {
- data
- ftable {
- {
- data
- prot {
- name {
- "kininogen-1" } ,
- activity {
- "maximakinin precursor" } } ,
- location
- whole
- gi 15072748 } ,
- {
- data
- prot {
- processed signal-peptide } ,
- location
- int {
- from 0 ,
- to 20 ,
- id
- gi 15072748 } ,
- qual {
- {
- qual "product" ,
- val "kininogen-1" } } } ,
- {
- data
- prot {
- name {
- "maxomakinin" } ,
- processed mature } ,
- location
- int {
- from 40 ,
- to 58 ,
- id
- gi 15072748 } } ,
- {
- data
- prot {
- name {
- "maxomakinin" } ,
- processed mature } ,
- location
- int {
- from 68 ,
- to 86 ,
- id
- gi 15072748 } } ,
- {
- data
- prot {
- name {
- "maxomakinin" } ,
- processed mature } ,
- location
- int {
- from 96 ,
- to 114 ,
- id
- gi 15072748 } } ,
- {
- data
- prot {
- name {
- "maxomakinin" } ,
- processed mature } ,
- location
- int {
- from 124 ,
- to 142 ,
- id
- gi 15072748 } } } } } } } ,
- annot {
- {
- data
- ftable {
- {
- data
- cdregion {
- frame one ,
- code {
- id 1 } } ,
- product
- whole
- gi 15072748 ,
- location
- int {
- from 97 ,
- to 555 ,
- id
- gi 15072747 } ,
- exp-ev experimental } } } } }